HPA003035

DHRSX antibody from Atlas Antibodies
DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003035, RRID:AB_611433
Product name
Anti-DHRSX
Provider product page
Atlas Antibodies - HPA003035
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAG
NNDSKAKQVVSKIKEETLNDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -