HPA003035

DHRSX antibody from Sigma-Aldrich
DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003035, RRID:AB_1080631
Product name
Anti-ZBED1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003035
Antibody type
Polyclonal
Antigen
Dehydrogenase/reductase SDR family member on chromosome X precursor (DHRSXY) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAG
NNDSKAKQVVSKIKEETLNDK
Storage
-20C
Provider Type Product Number
- No reagents -