Antibody data

Product number
H00056106-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056106-M04, RRID:AB_1137351
Product name
PCDHGA10 monoclonal antibody (M04), clone 3A7
Provider product page
Abnova Corporation - H00056106-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PCDHGA10.
Antigen sequence
SDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRV
SVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKL
PDTQLLKFQLNKYTGEIKISENLDYEET
Isotype
IgG
Antibody clone number
3A7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -