Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406607 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Proteasome (Prosome, Macropain) Subunit, alpha Type, 2 (PSMA2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VGIKAANGVVLATEKKQKSILYDERSVHKVEPITK
HIGLV YSGMGPDYRV- Vial size
- 50 µg
Submitted references Large-scale mapping of human protein-protein interactions by mass spectrometry.
Ewing RM, Chu P, Elisma F, Li H, Taylor P, Climie S, McBroom-Cerajewski L, Robinson MD, O'Connor L, Li M, Taylor R, Dharsee M, Ho Y, Heilbut A, Moore L, Zhang S, Ornatsky O, Bukhman YV, Ethier M, Sheng Y, Vasilescu J, Abu-Farha M, Lambert JP, Duewel HS, Stewart II, Kuehl B, Hogue K, Colwill K, Gladwish K, Muskat B, Kinach R, Adams SL, Moran MF, Morin GB, Topaloglou T, Figeys D
Molecular systems biology 2007;3:89
Molecular systems biology 2007;3:89
No comments: Submit comment
No validations: Submit validation data