Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026861 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026861, RRID:AB_1846192
- Product name
- Anti-CCPG1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWT
LTEAEKMSFETQKTNLATENQYLRVSLEKEEKALS
SLQEELNKLREQIRILEDKGTSTELVKENQKLKQH
LEEEKQKKHSFLSQRETLL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Baras A, Gandhi N, Munari E, Faraj S, Shultz L, Marchionni L, Schoenberg M, Hahn N, Hoque M, Berman D, Bivalacqua T, Netto G, Vlahou A
PLOS ONE 2015 July;10(7)
PLOS ONE 2015 July;10(7)
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC
BMC cancer 2014 Apr 5;14:244
BMC cancer 2014 Apr 5;14:244
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN