HPA024032

SPAG7 antibody from Atlas Antibodies
ACRP, FSA-1, MGC20134
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024032
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024032, RRID:AB_1857410
Product name
Anti-SPAG7
Provider product page
Atlas Antibodies - HPA024032
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKK
LQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQ
PMNKIERSILHDVVEVAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -