PAB21639

SPAG7 antibody from Abnova Corporation
ACRP, FSA-1, MGC20134

Antibody data

Product number
PAB21639
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21639, RRID:AB_10964659
Product name
SPAG7 polyclonal antibody
Provider product page
Abnova Corporation - PAB21639
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SPAG7.
Antigen sequence
ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKK
LQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQ
PMNKIERSILHDVVEVAG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -