HPA024032

SPAG7 antibody from Sigma-Aldrich
ACRP, FSA-1, MGC20134
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024032, RRID:AB_1857410
Product name
Anti-SPAG7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024032
Antibody type
Polyclonal
Antigen
Sperm-associated antigen 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKK
LQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQ
PMNKIERSILHDVVEVAG
Storage
-20C
Provider Type Product Number
- No reagents -