H00057595-B01P

PDZD4 antibody from Abnova Corporation
FLJ34125, KIAA1444, LNX5, LU1, PDZK4, PDZRN4L
No application information provided.

Antibody data

Product number
H00057595-B01P
Provider
Abnova Corporation
Product name
PDZD4 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00057595-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PDZD4 protein.
Antigen sequence
MGCNMCVVQKPEEQYKVMLQVNGKELSKLSQEQTL
QALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVDS
GTQTDITFEHIMALGKLRPPTPPMVILEPYVLSEL
PPISHEYYDPAEFMEGGPQEADRLDELEYEEVELY
KSSHRDKLGLMVCYRTDDEEDLGIYVGEVNPNSIA
AKDGRIREGDRIIQINGVDVQNREEAVAILSQEEN
TNISLLVARPESQLAKRWKDSDRDDFLDDFGSENE
GELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNSQ
ELDSGVGRTDESTRNEESSEHDLLGDEPPSSTNTP
GSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGG
DVPGLTDEEYERYRELLEIKCHLENGNQLGLLFPR
ASGGNSALDVNRNESLGHEMAMLEEELRHLEFKCR
NILRAQKMQQLRERCMKAWLLEEESLYDLAASEPK
KHELSDISELPEKSDKDSTSAYNTGESCRSTPLLV
EPLPESPLRRAMAGNSNLNRTPPGPAVATPAKAAP
PPGSPAKFRSLSRDPEAGRRQHAEERGRRNPKTGL
TLERVGPESSPYLSRRHRGQGQEGEHYHSCVQLAP
TRGLEELGHGPLSLAGGPRVGGVAAAATEAPRMEW
KVKVRSDGTRYVAKRPVRDRLLKARALKIREERSG
MTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKR
REFMMQSRLECLREQQNGDSKPELNIIALSHRKTM
KKRNKKILDNWITIQEMLAHGARSADGKRVYNPLL
SVTTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -