HPA003878

PDZD4 antibody from Sigma-Aldrich
FLJ34125, KIAA1444, LU1, PDZK4, PDZRN4L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003878, RRID:AB_2162807
Product name
Anti-PDZD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003878
Antibody type
Polyclonal
Antigen
PDZ domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTNISLLVARPESQLAKRWKDSDRDDFLDDFGSEN
EGELRARKLKSPPAQQPGNEEEKGAPDAGPGLSNS
QELDSGVGRTDESTRNEESSEHDLLGDEPPSSTNT
PGSLRKFGLQGDALQSRDFHFSMDSL
Storage
-20C
Provider Type Product Number
- No reagents -