H00027344-B01

PCSK1N antibody from Abnova Corporation
BigLEN, PEN, proSAAS, SAAS, SCG8, SgVIII

Antibody data

Product number
H00027344-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027344-B01, RRID:AB_1138764
Product name
PCSK1N MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00027344-B01
Antibody type
Polyclonal
Antigen
PCSK1N (NP_037403, 1 a.a. ~ 260 a.a) full-length human protein.
Reactivity
Human, Rat
Host
Mouse
Antigen sequence
MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCAR
PVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAG
AVQELARALAHLLEAERQERARAEAQEAEDQQARV
LAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARAL
LRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGP
AGPDAEEAGDETPDVDPELLRYLLGRILAGSADSE
GVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRL
ETPAPQVPARRLLPP
Vial size
50 µl
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -