HPA000948

ANGEL1 antibody from Atlas Antibodies
Ccr4e, KIAA0759
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000948
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000948, RRID:AB_2227189
Product name
Anti-ANGEL1
Provider product page
Atlas Antibodies - HPA000948
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLL
RFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAES
VLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLP
QRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTD
HRLYRDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -