HPA000948

ANGEL1 antibody from Sigma-Aldrich
Ccr4e, KIAA0759
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000948, RRID:AB_2227189
Product name
Anti-ANGEL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000948
Antibody type
Polyclonal
Antigen
Protein angel homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLL
RFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAES
VLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLP
QRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTD
HRLYRDG
Storage
-20C
Provider Type Product Number
- No reagents -