HPA003626

BRS3 antibody from Sigma-Aldrich
BB3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003626
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003626, RRID:AB_1078295
Product name
Anti-BRS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003626
Antibody type
Polyclonal
Antigen
Bombesin receptor subtype-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTV
PGTGSIQMSEISVTSFTGCSVKQAEDRF
Storage
-20C
Provider Type Product Number
- No reagents -