HPA024142

USP25 antibody from Sigma-Aldrich
USP21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024142, RRID:AB_1858673
Product name
Anti-USP25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024142
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQ
NNKELLSKGLYRGHDEELISHYRRECLLKLNEQAA
ELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEME
EKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLP
KLLDCSMEIK
Storage
-20C
Provider Type Product Number
- No reagents -