HPA018297

antibody from Atlas Antibodies

Targeting: USP25 USP21

Antibody data

Submit

Validation data

Product number: HPA018297 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018297, RRID:AB_1858672
Product name: Anti-USP25
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQL AQKALQEKLLASQKLRESETSVTTAQAAGDPEYLE QPSRSDFSKHLKEETIQIITKASHEHEDKSPETVL QSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

USP25 protein structure - HPA018297 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting USP25 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting USP25 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:478
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no: s223827
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no 2: s26560
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s26561
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R07715
Appendix: 560bd4d13fb7f.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-USP25 antibody. Remaining relative intensity is presented.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp