HPA018297

USP25 antibody from Atlas Antibodies
USP21
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA018297
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018297, RRID:AB_1858672
Product name
Anti-USP25
Provider product page
Atlas Antibodies - HPA018297
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQL
AQKALQEKLLASQKLRESETSVTTAQAAGDPEYLE
QPSRSDFSKHLKEETIQIITKASHEHEDKSPETVL
QSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -