HPA003972

PDZD11 antibody from Sigma-Aldrich
PDZK11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003972
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003972, RRID:AB_1855165
Product name
Anti-PDZD11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003972
Antibody type
Polyclonal
Antigen
PDZ domain-containing protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNE
LTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFI
SKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSK
AVEILKTAREISMRVRFFPYNYHR
Storage
-20C
Provider Type Product Number
- No reagents -