HPA003628

TIMM8A antibody from Atlas Antibodies
DDP, DFN1, MTS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003628
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003628, RRID:AB_1080284
Product name
Anti-TIMM8A
Provider product page
Atlas Antibodies - HPA003628
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWE
KCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNR
LEQTQKSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -