HPA003628

TIMM8A antibody from Atlas Antibodies
DDP, DFN1, MTS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003628
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003628, RRID:AB_611843
Product name
Anti-TIMM8A
Provider product page
Atlas Antibodies - HPA003628
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWE
KCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNR
LEQTQKSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -