HPA003628

TIMM8A antibody from Sigma-Aldrich
DDP, DFN1, MTS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003628
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003628, RRID:AB_1080284
Product name
Anti-TIMM8A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003628
Antibody type
Polyclonal
Antigen
Mitochondrial import inner membrane translocase subunit Tim8 A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWE
KCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNR
LEQTQKSK
Storage
-20C
Provider Type Product Number
- No reagents -