HPA016839

ZNF831 antibody from Sigma-Aldrich
C20orf174, dJ492J12.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016839, RRID:AB_1859466
Product name
Anti-ZNF831 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016839
Antibody type
Polyclonal
Antigen
Uncharacterized protein C20orf174
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESPPCCGKEEKKEGDCRQTLGTLSLGTSSRIVREM
DKRTVKDISPSAGEHGDCTTHSTAATSGLSLQSDT
CLAVVNDVPLPPGKGLDLGLLETQLLASQDSVSTD
PKPYIFSDAQRPSSFGSKGTFPHHD
Storage
-20C
Provider Type Product Number
- No reagents -