Antibody data

Product number
PAB21579
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21579, RRID:AB_10963618
Product name
KIAA0753 polyclonal antibody
Provider product page
Abnova Corporation - PAB21579
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant KIAA0753.
Antigen sequence
LKAEEMYRLQQLSVSATHLADKVEEAVLDRLKPLL
VKAQRVNSTTEANIHLKDGSSVNTAKAQPAQEVAA
VDFESNNIRQLDDFLEDCASELWAVTHAKILGSE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -