HPA023494

KIAA0753 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023494
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023494, RRID:AB_1852339
Product name
Anti-KIAA0753 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023494
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0753 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKAEEMYRLQQLSVSATHLADKVEEAVLDRLKPLL
VKAQRVNSTTEANIHLKDGSSVNTAKAQPAQEVAA
VDFESNNIRQLDDFLEDCASELWAVTHAKILGSE
Storage
-20C
Provider Type Product Number
- No reagents -