HPA005470

LANCL3 antibody from Atlas Antibodies
FLJ42925
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005470
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005470, RRID:AB_2134886
Product name
Anti-LANCL3
Provider product page
Atlas Antibodies - HPA005470
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VAYMLYHVSQSPLFATARERYLRSAKRLIDACARA
EEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRS
DYVQPLGKFRALCAVC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -