HPA005470

LANCL3 antibody from Sigma-Aldrich
FLJ42925
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005470
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005470, RRID:AB_2134886
Product name
Anti-LANCL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005470
Antibody type
Polyclonal
Antigen
LanC lantibiotic synthetase component C-like 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAYMLYHVSQSPLFATARERYLRSAKRLIDACARA
EEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRS
DYVQPLGKFRALCAVC
Storage
-20C
Provider Type Product Number
- No reagents -