PAB20231

SLC7A3 antibody from Abnova Corporation
ATRC3, CAT-3, FLJ14541

Antibody data

Product number
PAB20231
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20231, RRID:AB_10964155
Product name
SLC7A3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20231
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC7A3.
Antigen sequence
RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFF
PLNSIPTPLSGQI
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -