ARP43806_P050
SLC7A3 antibody from Aviva Systems Biology
Eligible for validation within the Antibodypedia Validation Initiative
ATRC3, CAT-3, FLJ14541
Eligible for validation within the Antibodypedia Validation Initiative
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP43806_P050
- Provider
- Aviva Systems Biology
- Proper citation
- Aviva Systems Biology Cat#ARP43806_P050, RRID:AB_10869356
- Product name
- Slc7a3 antibody - middle region (ARP43806_P050)
- Provider product page
- Aviva Systems Biology - ARP43806_P050
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- This is a rabbit polyclonal antibody against Slc7a3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYP
DFFALALVLLLTGLL- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Handling
- Add 50 µl of distilled water. Final anti-Slc7a3 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
| Provider | Type | Product Number |
|---|---|---|
| - No reagents - | ||
