HPA003629

SLC7A3 antibody from Atlas Antibodies
ATRC3, CAT-3, FLJ14541
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003629
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003629, RRID:AB_2190964
Product name
Anti-SLC7A3
Provider product page
Atlas Antibodies - HPA003629
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFF
PLNSIPTPLSGQI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -