HPA003629

SLC7A3 antibody from Sigma-Aldrich
ATRC3, CAT-3, FLJ14541
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003629
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003629, RRID:AB_2190964
Product name
Anti-SLC7A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003629
Antibody type
Polyclonal
Antigen
Cationic amino acid transporter 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFF
PLNSIPTPLSGQI
Storage
-20C
Provider Type Product Number
- No reagents -