HPA021865

ASMTL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021865
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021865, RRID:AB_1845099
Product name
Anti-ASMTL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021865
Antibody type
Polyclonal
Antigen
N-acetylserotonin O-methyltransferase-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLLDICAAMGLLEKTEQGYSNTETANVYLASDGEY
SLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRAL
GKKAEDLFQDAYYQSPETRLRFMRAMHGMTKLTAC
QVATAFNLSRFSSACDVGGCTGALARELAREYPRM
QVTV
Storage
-20C
Provider Type Product Number
- No reagents -