HPA011369

LMO1 antibody from Sigma-Aldrich
RBTN1, RHOM1, TTG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011369
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011369, RRID:AB_1852957
Product name
Anti-LMO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011369
Antibody type
Polyclonal
Antigen
Rhombotin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEPASCPRTGRPAKARPESAPFSRPSLAAAGHGAP
EMMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDR
YLLKALDKY
Storage
-20C
Provider Type Product Number
- No reagents -