HPA003631

P2RY8 antibody from Atlas Antibodies
P2Y8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003631
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003631, RRID:AB_1079543
Product name
Anti-P2RY8
Provider product page
Atlas Antibodies - HPA003631
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQL
RLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEA
GAHPEGMEGATRPGLQRQESVF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -