HPA027420

TRIM66 antibody from Atlas Antibodies
C11orf29, KIAA0298, TIF1D

Antibody data

Product number
HPA027420
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027420, RRID:AB_1858316
Product name
Anti-TRIM66
Provider product page
Atlas Antibodies - HPA027420
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLERLKICAASSGEMPVFKLKPQKNDQDGSFLLII
ECGTESSSMSIKVSQDRLSEATQAPGLEGRKVTVT
SLAGQRPPEVEGTSPEEHRLIPRTP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.