HPA003905

GPR173 antibody from Atlas Antibodies
SREB3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003905, RRID:AB_1078922
Product name
Anti-GPR173
Provider product page
Atlas Antibodies - HPA003905
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRG
PMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRM
FY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -