HPA017864

SERPINA6 antibody from Sigma-Aldrich
CBG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017864, RRID:AB_1856721
Product name
Anti-SERPINA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017864
Antibody type
Polyclonal
Antigen
Corticosteroid-binding globulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQ
VDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANF
SRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGV
TLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARV
MN
Storage
-20C
Provider Type Product Number
- No reagents -