HPA017864

SERPINA6 antibody from MilliporeSigma / Merck KGaA
CBG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017864
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SERPINA6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017864
Antibody type
Polyclonal
Antigen
Corticosteroid-binding globulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQ
VDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANF
SRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGV
TLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARV
MN
Storage
-20C