Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010134-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010134-A01, RRID:AB_462509
- Product name
- BCAP31 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant BCAP31.
- Antigen sequence
KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVG
NAEVKLEEENRSLKADLQKLKDELASTKQKLEKAE
NQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPM
DKKEE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAP31 polyclonal antibody (A01), Lot # ABNOVA060705QCS1 Western Blot analysis of BCAP31 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAP31 polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of BCAP31 expression in Jurkat.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAP31 polyclonal antibody (A01), Lot # ABNOVA060705QCS1. Western Blot analysis of BCAP31 expression in NIH/3T3.