H00010134-B01P

BCAP31 antibody from Abnova Corporation
6C6-Ag, BAP31, CDM, DXS1357E

Antibody data

Product number
H00010134-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010134-B01P, RRID:AB_1571656
Product name
BCAP31 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010134-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human BCAP31 protein.
Antigen sequence
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKI
FKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI
RKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYI
AGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEV
KLEEENRSLKADLQKLKDELASTKQKLEKAENQVL
AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKE
E
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -