Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010134-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010134-M01A, RRID:AB_1571657
- Product name
- BCAP31 monoclonal antibody (M01A), clone 3C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BCAP31.
- Antigen sequence
KKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVG
NAEVKLEEENRSLKADLQKLKDELASTKQKLEKAE
NQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPM
DKKEE- Isotype
- IgG
- Antibody clone number
- 3C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in HeLa(Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BCAP31 monoclonal antibody (M01A), clone 3C5. Western Blot analysis of BCAP31 expression in human kidney.