HPA003906

BCAP31 antibody from Sigma-Aldrich
6C6-Ag, BAP31, CDM, DXS1357E
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003906
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003906, RRID:AB_1078270
Product name
Anti-BCAP31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003906
Antibody type
Polyclonal
Antigen
B-cell receptor-associated protein 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEV
KLEEENRSLKADLQKLKDELASTKQKLEKAENQVL
AMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
Storage
-20C
Provider Type Product Number
- No reagents -