Antibody data

Product number
H00001068-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001068-M05, RRID:AB_1137133
Product name
CETN1 monoclonal antibody (M05), clone 4C12
Provider product page
Abnova Corporation - H00001068-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CETN1.
Antigen sequence
KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDA
KELKVAMRALGFEPRKEEMKKMISEVDREGTGKIS
FNDFLAVMT
Isotype
IgG
Antibody clone number
4C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -