HPA004773

CT83 antibody from Atlas Antibodies
CXorf61, FLJ20611, FLJ22913, KK-LC-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004773
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004773, RRID:AB_2245776
Product name
Anti-CT83
Provider product page
Atlas Antibodies - HPA004773
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAV
YDLSRDILNNFPHSIARQKRILVNLSMVENKLVEL
EHTLLSKGFRGASPHRKST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -