HPA004773

CT83 antibody from Sigma-Aldrich
CXorf61, FLJ20611, FLJ22913, KK-LC-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004773
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004773, RRID:AB_2245776
Product name
Anti-CXorf61 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004773
Antibody type
Polyclonal
Antigen
Kita-kyushu lung cancer antigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAV
YDLSRDILNNFPHSIARQKRILVNLSMVENKLVEL
EHTLLSKGFRGASPHRKST
Storage
-20C
Provider Type Product Number
- No reagents -