HPA018400

BTG3 antibody from Sigma-Aldrich
ANA, tob55
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018400
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018400, RRID:AB_1845487
Product name
Anti-BTG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018400
Antibody type
Polyclonal
Antigen
Protein BTG3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRK
VTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT
Storage
-20C
Provider Type Product Number
- No reagents -