Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018400 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018400, RRID:AB_1845487
- Product name
- Anti-BTG3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRK
VTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Decreased expression of BTG3 was linked to carcinogenesis, aggressiveness, and prognosis of ovarian carcinoma.
Deng B, Zhao Y, Gou W, Chen S, Mao X, Takano Y, Zheng H
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2013 Oct;34(5):2617-24
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2013 Oct;34(5):2617-24
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and BTG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416410).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells along with extracellular material.
- Sample type
- HUMAN