Antibody data

Product number
HPA043640
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043640, RRID:AB_2678594
Product name
Anti-TUBB8
Provider product page
Atlas Antibodies - HPA043640
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SILPSPKVSDTVVEPYNATLSVHQLIENADETFCI
DNEALYDICS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.