Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA043640 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA043640, RRID:AB_2678594
- Product name
- Anti-TUBB8
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SILPSPKVSDTVVEPYNATLSVHQLIENADETFCI
DNEALYDICS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Exploring Extracellular Vesicle Surface Protein Markers Produced by Glioblastoma Tumors: A Characterization Study Using In Vitro 3D Patient-Derived Cultures
MYC regulates fatty acid metabolism through a multigenic program in claudin-low triple negative breast cancer
Mitochondrial enzyme GLUD2 plays a critical role in glioblastoma progression
Franceschi S, Lessi F, Morelli M, Menicagli M, Aretini P, Gambacciani C, Pieri F, Grimod G, Trapanese M, Valenti S, Paiar F, Di Stefano A, Santonocito O, Pasqualetti F, Mazzanti C
Cancers 2024;16(22):3748
Cancers 2024;16(22):3748
MYC regulates fatty acid metabolism through a multigenic program in claudin-low triple negative breast cancer
Casciano J, Perry C, Cohen-Nowak A, Miller K, Vande Voorde J, Zhang Q, Chalmers S, Sandison M, Liu Q, Hedley A, McBryan T, Tang H, Gorman N, Beer T, Speicher D, Adams P, Liu X, Schlegel R, McCarron J, Wakelam M, Gottlieb E, Kossenkov A, Schug Z
British Journal of Cancer 2020;122(6):868-884
British Journal of Cancer 2020;122(6):868-884
Mitochondrial enzyme GLUD2 plays a critical role in glioblastoma progression
Franceschi S, Corsinovi D, Lessi F, Tantillo E, Aretini P, Menicagli M, Scopelliti C, Civita P, Pasqualetti F, Naccarato A, Ori M, Mazzanti C
EBioMedicine 2018;37
EBioMedicine 2018;37
No comments: Submit comment
No validations: Submit validation data