HPA000857

RPS4Y1 antibody from Sigma-Aldrich
MGC119100, MGC5070, RPS4Y, S4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000857, RRID:AB_1079849
Product name
Anti-RPS4Y1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000857
Antibody type
Polyclonal
Antigen
40S ribosomal protein S4, Y isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDT
VQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGV
ITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIG
NGNKPWISLPRGKGIRLTVA
Storage
-20C
Provider Type Product Number
- No reagents -