Antibody data

Product number
H00009426-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009426-M06, RRID:AB_1573922
Product name
CDY2A monoclonal antibody (M06), clone 2E2
Provider product page
Abnova Corporation - H00009426-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDY2A.
Antigen sequence
ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGF
QKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPG
AEQTGIQNKTQMHPLMSQMSGS
Isotype
IgG
Antibody clone number
2E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -