HPA014536

FGD5 antibody from Sigma-Aldrich
FLJ00274, FLJ39957, ZFYVE23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014536, RRID:AB_1848518
Product name
Anti-FGD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014536
Antibody type
Polyclonal
Antigen
FYVE, RhoGEF and PH domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFS
RTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADT
SDYENIPAMNSDYENIQIPPRRPARAGAFTKLFED
QSRALSTANENDGYVD
Storage
-20C
Provider Type Product Number
- No reagents -