HPA003959

SRY antibody from Sigma-Aldrich
TDF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003959, RRID:AB_1857487
Product name
Anti-SRY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003959
Antibody type
Polyclonal
Antigen
Sex-determining region Y protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWK
MLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRK
AKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCT
KATHSRMEHQLGHLPPINAASSPQQRDRYS
Storage
-20C
Provider Type Product Number
- No reagents -