Antibody data

Product number
ABIN406510
Provider
antibodies-online
Product name
anti-Heat Shock 70kDa Protein 2 (HSPA2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406510
Antibody type
Polyclonal
Antigen
The immunogen for anti-HSPA2 antibody: synthetic peptide directed towards the middle region of human HSPA2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDR
VAAKN ALESYTYNIK
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -