Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000798 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000798, RRID:AB_1079090
- Product name
- Anti-HSPA2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMV
QEAERYKSEDEANRDRVAAKNALESYTYNIKQTVE
DEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEK
DEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGS
GASGGPTIEE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression, function, and regulation of the testis-enriched heat shock HSPA2 gene in rodents and humans.
HSP70-binding protein HSPBP1 regulates chaperone expression at a posttranslational level and is essential for spermatogenesis.
The molecular chaperone Hsp90α is required for meiotic progression of spermatocytes beyond pachytene in the mouse.
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Scieglinska D, Krawczyk Z
Cell stress & chaperones 2015 Mar;20(2):221-35
Cell stress & chaperones 2015 Mar;20(2):221-35
HSP70-binding protein HSPBP1 regulates chaperone expression at a posttranslational level and is essential for spermatogenesis.
Rogon C, Ulbricht A, Hesse M, Alberti S, Vijayaraj P, Best D, Adams IR, Magin TM, Fleischmann BK, Höhfeld J
Molecular biology of the cell 2014 Aug 1;25(15):2260-71
Molecular biology of the cell 2014 Aug 1;25(15):2260-71
The molecular chaperone Hsp90α is required for meiotic progression of spermatocytes beyond pachytene in the mouse.
Grad I, Cederroth CR, Walicki J, Grey C, Barluenga S, Winssinger N, De Massy B, Nef S, Picard D
PloS one 2010 Dec 31;5(12):e15770
PloS one 2010 Dec 31;5(12):e15770
Systematically generated antibodies against human gene products: High throughput screening on sections from the rat nervous system
Mulder J, Wernérus H, Shi T, Pontén F, Hober S, Uhlén M, Hökfelt T
Neuroscience 2007 June;146(4):1689-1703
Neuroscience 2007 June;146(4):1689-1703
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSPA2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and pancreas tissues using HPA000798 antibody. Corresponding HSPA2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear and cytoplasmic positivity in decidual cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse thalamus shows strong immunoreactivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse somatosensory cortex shows strong immunoreactivity in neuronal cell bodies.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse amygdala shows positivity in neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate immunoreactivity in neuropil and neuronal cell bodies.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong immunoreactivity in a subset of glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the thalamus.
- Sample type
- MOUSE