HPA000798

HSPA2 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000798
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000798, RRID:AB_1079090
Product name
Anti-HSPA2
Provider product page
Atlas Antibodies - HPA000798
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMV
QEAERYKSEDEANRDRVAAKNALESYTYNIKQTVE
DEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEK
DEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGS
GASGGPTIEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -